Structure of PDB 8azw Chain R

Receptor sequence

>8azwR (length=126) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

AVPLLTKKVVKKRVKRFIRPQSDRRITVKESWRRPKGIDSRVRRKFKGCV
LMPNIGYGSDKKTRHYLPNGFKKFVVHNASELEVLMMHNRTYCAEIAHNV
STRKRKEIVERAAQLDVVITNKLARL

3D structure

PDB

8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.14 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	A2 K8 K12 K13 R14 V15 K16 R17 F18 R20 Q22 D24 R25 R26 I27 T28 V29 S32 W33 R34 R35 K37 G38 I39 D40 S41 R42 R44 R45 K46 F47 K48 G49 C50 P54 N55 I56 G57 Y58 G59 S60 D61 K62 K63 R65 H66 L68 P69 F72 K74 H78 N79 E96 A98 H99 N100 S102 T103 R104 K105 R106 V119 A125 R126	A1 K7 K11 K12 R13 V14 K15 R16 F17 R19 Q21 D23 R24 R25 I26 T27 V28 S31 W32 R33 R34 K36 G37 I38 D39 S40 R41 R43 R44 K45 F46 K47 G48 C49 P53 N54 I55 G56 Y57 G58 S59 D60 K61 K62 R64 H65 L67 P68 F71 K73 H77 N78 E95 A97 H98 N99 S101 T102 R103 K104 R105 V118 A124 R125

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links