Structure of PDB 7zqk Chain R

Receptor sequence

>7zqkR (length=337) Species: 3055 (Chlamydomonas reinhardtii)

KIRVAINGFGRIGRNFLRCWHGRQNTLLDVVAINDSGGVKQASHLLKYDS
TLGTFAADVKIVDDSHISVDGKQIKIVSSRDPLQLPWKEMNIDLVIEGTG
VFIDKVGAGKHIQAGASKVLITAPAKDKDIPTFVVGVNEGDYKHEYPIIS
NASCTTNCLAPFVKVLEQKFGIVKGTMTTTHSYTGDQRLLDASHRDLRRA
RAAALNIVPTTTGAAKAVSLVLPSLKGKLNGIALRVPTPTVSVVDLVVQV
EKKTFAEEVNAAFREAANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASL
TMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAKKWV

3D structure

• PDB: 7zqk Structural snapshots of nitrosoglutathione binding and reactivity underlying S-nitrosylation of photosynthetic GAPDH.
• Chain: R
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 1.2.1.13: glyceraldehyde-3-phosphate dehydrogenase (NADP(+)) (phosphorylating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	R	G9 R10 I11 R77 T119 C149 N313 Y317	G10 R11 I12 R80 T122 C154 N317 Y321

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016491 oxidoreductase activity
• GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
• GO:0019900 kinase binding
• GO:0042802 identical protein binding
• GO:0047100 glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) activity
• GO:0050661 NADP binding
• GO:0051287 NAD binding

Biological Process

• GO:0006006 glucose metabolic process
• GO:0019253 reductive pentose-phosphate cycle

Cellular Component

• GO:0009507 chloroplast
• GO:0099080 supramolecular complex

External links

• PDB: RCSB:7zqk, PDBe:7zqk, PDBj:7zqk
• PDBsum: 7zqk
• PubMed: 35793584
• UniProt: P50362|G3PA_CHLRE Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Gene Name=GAPA)