Structure of PDB 7zi4 Chain R

Receptor sequence
>7zi4R (length=101) Species: 9606 (Homo sapiens) [Search protein sequence]
LTEEMLLKREERARKRRLQAARRAEEHKNPMVRYCSGAQGSTLSFPPGVP
APTAVSQRPSPSGPPPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQM
R
3D structure
PDB7zi4 Cryo-EM structure of the human INO80 complex bound to a WT nucleosome
ChainR
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN R C309 C314 C330 C334 C68 C73 C89 C93
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000723 telomere maintenance
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006282 regulation of DNA repair
GO:0006310 DNA recombination
GO:0006338 chromatin remodeling
GO:0033044 regulation of chromosome organization
GO:0045739 positive regulation of DNA repair
GO:0045893 positive regulation of DNA-templated transcription
GO:0045995 regulation of embryonic development
GO:0051726 regulation of cell cycle
GO:0060382 regulation of DNA strand elongation
GO:1904507 positive regulation of telomere maintenance in response to DNA damage
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0016604 nuclear body
GO:0031011 Ino80 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zi4, PDBe:7zi4, PDBj:7zi4
PDBsum7zi4
PubMed
UniProtQ9C086|IN80B_HUMAN INO80 complex subunit B (Gene Name=INO80B)

[Back to BioLiP]