Structure of PDB 7zdi Chain R

Receptor sequence
>7zdiR (length=49) Species: 1076 (Rhodopseudomonas palustris) [Search protein sequence]
DDPNKVWPTGLTIAESEELHKHVIDGTRIFGAIAIVAHFLAYVYSPWLH
3D structure
PDB7zdi Cryo-EM structures of light-harvesting 2 complexes from Rhodopseudomonas palustris reveal the molecular origin of absorption tuning.
ChainR
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL R R30 A34 R28 A32
BS02 IRM R L21 H24 G28 T29 L19 H22 G26 T27
BS03 BCL R I26 R30 I24 R28
BS04 BCL R F32 I35 A36 A39 H40 F30 I33 A34 A37 H38
BS05 BCL R T29 F32 G33 H40 W49 T27 F30 G31 H38 W47
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zdi, PDBe:7zdi, PDBj:7zdi
PDBsum7zdi
PubMed36251992
UniProtP35107|LHB2_RHOPA Light-harvesting protein B-800-850 beta chain B (Gene Name=pucBB)

[Back to BioLiP]