Structure of PDB 7zah Chain R

Receptor sequence
>7zahR (length=107) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]
RDIGLRIQPPAEKCDDPKCPWHGHLKIHGRVFEGIVVSDKPRKTVTVERQ
YYHYLKKYERYELRRSRIHAHNPPCINAKVGDRVLIAETRPLSKTKHFVV
VAVLERA
3D structure
PDB7zah Role of aIF5B in archaeal translation initiation.
ChainR
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R H26 K28 I29 H30 K42 P43 R44 K59 E61 L65 R66 R67 S68 H71 R92 P93 S95 K96 T97 K98 H99 F100 H24 K26 I27 H28 K40 P41 R42 K57 E59 L63 R64 R65 S66 H69 R90 P91 S93 K94 T95 K96 H97 F98
BS02 ZN R C16 C21 H24 C77 C14 C19 H22 C75
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zah, PDBe:7zah, PDBj:7zah
PDBsum7zah
PubMed35694843
UniProtQ9V1U5|RS17_PYRAB Small ribosomal subunit protein uS17 (Gene Name=rps17)

[Back to BioLiP]