Structure of PDB 7z8r Chain R

Receptor sequence
>7z8rR (length=86) Species: 9606 (Homo sapiens) [Search protein sequence]
RFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTV
AWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKY
3D structure
PDB7z8r Systemwide disassembly and assembly of SCF ubiquitin ligase complexes.
ChainR
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
2.3.2.32: cullin-RING-type E3 NEDD8 transferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN R C42 C45 H80 C83 C22 C25 H60 C63
BS02 ZN R C75 H77 C94 D97 C55 H57 C74 D77
BS03 ZN R C56 H82 C36 H62
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016740 transferase activity
GO:0019788 NEDD8 transferase activity
GO:0031625 ubiquitin protein ligase binding
GO:0034450 ubiquitin-ubiquitin ligase activity
GO:0046872 metal ion binding
GO:0060090 molecular adaptor activity
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0061630 ubiquitin protein ligase activity
GO:0061663 NEDD8 ligase activity
GO:0097602 cullin family protein binding
Biological Process
GO:0000165 MAPK cascade
GO:0000209 protein polyubiquitination
GO:0006281 DNA repair
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0006513 protein monoubiquitination
GO:0006974 DNA damage response
GO:0007283 spermatogenesis
GO:0016567 protein ubiquitination
GO:0030163 protein catabolic process
GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032480 negative regulation of type I interferon production
GO:0034644 cellular response to UV
GO:0042110 T cell activation
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043687 post-translational protein modification
GO:0045116 protein neddylation
GO:0045732 positive regulation of protein catabolic process
GO:0062197 cellular response to chemical stress
GO:0070936 protein K48-linked ubiquitination
GO:0071230 cellular response to amino acid stimulus
GO:0090090 negative regulation of canonical Wnt signaling pathway
GO:0140627 ubiquitin-dependent protein catabolic process via the C-end degron rule pathway
GO:1900076 regulation of cellular response to insulin stimulus
GO:1902499 positive regulation of protein autoubiquitination
GO:1902883 negative regulation of response to oxidative stress
GO:1904263 positive regulation of TORC1 signaling
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0019005 SCF ubiquitin ligase complex
GO:0031461 cullin-RING ubiquitin ligase complex
GO:0031462 Cul2-RING ubiquitin ligase complex
GO:0031463 Cul3-RING ubiquitin ligase complex
GO:0031464 Cul4A-RING E3 ubiquitin ligase complex
GO:0031465 Cul4B-RING E3 ubiquitin ligase complex
GO:0031466 Cul5-RING ubiquitin ligase complex
GO:0031467 Cul7-RING ubiquitin ligase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7z8r, PDBe:7z8r, PDBj:7z8r
PDBsum7z8r
PubMed37028429
UniProtP62877|RBX1_HUMAN E3 ubiquitin-protein ligase RBX1 (Gene Name=RBX1)

[Back to BioLiP]