Structure of PDB 7yu6 Chain R

Receptor sequence
>7yu6R (length=290) Species: 9606 (Homo sapiens) [Search protein sequence]
QCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVCIFIMLANLLVMV
AIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVSTWL
LRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIW
TMAIVMGAIPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMV
VLYAHIFGYVRQRTMRMDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVC
CPQCDVLAYEKFFLLLAEFNSAMNPIIYSYRDKEMSATFR
3D structure
PDB7yu6 Structure of the active G i -coupled human lysophosphatidic acid receptor 1 complexed with a potent agonist.
ChainR
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 K6L R K39 T109 R124 Y202 W210 E293 K294 L297 K17 T87 R102 Y180 W188 E260 K261 L264
Gene Ontology
Molecular Function
GO:0001965 G-protein alpha-subunit binding
GO:0004930 G protein-coupled receptor activity
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0008289 lipid binding
GO:0030165 PDZ domain binding
GO:0035727 lysophosphatidic acid binding
GO:0070915 lysophosphatidic acid receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0008360 regulation of cell shape
GO:0010977 negative regulation of neuron projection development
GO:0014003 oligodendrocyte development
GO:0019222 regulation of metabolic process
GO:0021549 cerebellum development
GO:0021554 optic nerve development
GO:0022008 neurogenesis
GO:0022038 corpus callosum development
GO:0032060 bleb assembly
GO:0035025 positive regulation of Rho protein signal transduction
GO:0042552 myelination
GO:0043065 positive regulation of apoptotic process
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0043410 positive regulation of MAPK cascade
GO:0043951 negative regulation of cAMP-mediated signaling
GO:0051496 positive regulation of stress fiber assembly
GO:0060326 cell chemotaxis
GO:0060999 positive regulation of dendritic spine development
GO:0071453 cellular response to oxygen levels
GO:0071673 positive regulation of smooth muscle cell chemotaxis
GO:0098693 regulation of synaptic vesicle cycle
GO:0099149 regulation of postsynaptic neurotransmitter receptor internalization
GO:1902018 negative regulation of cilium assembly
GO:1904566 cellular response to 1-oleoyl-sn-glycerol 3-phosphate
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005886 plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0030139 endocytic vesicle
GO:0042734 presynaptic membrane
GO:0043025 neuronal cell body
GO:0043197 dendritic spine
GO:0043198 dendritic shaft
GO:0045211 postsynaptic membrane
GO:0098978 glutamatergic synapse
GO:0098982 GABA-ergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yu6, PDBe:7yu6, PDBj:7yu6
PDBsum7yu6
PubMed36109516
UniProtQ92633|LPAR1_HUMAN Lysophosphatidic acid receptor 1 (Gene Name=LPAR1)

[Back to BioLiP]