Structure of PDB 7yfd Chain R

Receptor sequence

>7yfdR (length=261) Species: 9606 (Homo sapiens)

LSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAISD
FFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYD
RYLSVSNAVSYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKGSE
CEPGFFSEWYILAITSFLEFVIPVILVAYFNMNIYWSLWKRARRLAKSLA
ILLGVFAVCWAPYSLFTIVLSFYKSVWYRIAFWLQWFNSFVNPLLYPLCH
KRFQKAFLKIF

3D structure

• PDB: 7yfd Structural insights into the agonists binding and receptor selectivity of human histamine H4 receptor
• Chain: R
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ITF	R	D94 Y95 C98 E182 F344 Q347 W348	D83 Y84 C87 E169 F232 Q235 W236
BS02	CLR	R	V133 W140	V122 W129
BS03	CLR	R	Y103 L107 Y110 L181 I185 L189	Y92 L96 Y99 L168 I172 L176

Gene Ontology

Molecular Function

• GO:0004930 G protein-coupled receptor activity
• GO:0004969 histamine receptor activity
• GO:0004993 G protein-coupled serotonin receptor activity
• GO:0016907 G protein-coupled acetylcholine receptor activity

Biological Process

• GO:0006954 inflammatory response
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
• GO:0007197 adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway
• GO:0007204 positive regulation of cytosolic calcium ion concentration
• GO:0007268 chemical synaptic transmission
• GO:0008150 biological_process
• GO:0043408 regulation of MAPK cascade
• GO:0098664 G protein-coupled serotonin receptor signaling pathway

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0030425 dendrite
• GO:0045202 synapse

External links

• PDB: RCSB:7yfd, PDBe:7yfd, PDBj:7yfd
• PDBsum: 7yfd
• PubMed: 37863901
• UniProt: Q9H3N8|HRH4_HUMAN Histamine H4 receptor (Gene Name=HRH4)