Structure of PDB 7y8w Chain R

Receptor sequence
>7y8wR (length=87) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]
VDRKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYN
PTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKS
3D structure
PDB7y8w Interaction between DLC-1 and SAO-1 facilitates CED-4 translocation during apoptosis in the Caenorhabditis elegans germline.
ChainR
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R K9 D12 N61 F62 G63 S64 Y65 V66 T67 H68 E69 F73 Y75 K8 D11 N60 F61 G62 S63 Y64 V65 T66 H67 E68 F72 Y74
BS02 peptide R E35 K36 E34 K35
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0045505 dynein intermediate chain binding
Biological Process
GO:0006915 apoptotic process
GO:0007017 microtubule-based process
GO:0030473 nuclear migration along microtubule
GO:0051301 cell division
GO:0051321 meiotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0015630 microtubule cytoskeleton
GO:0030286 dynein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y8w, PDBe:7y8w, PDBj:7y8w
PDBsum7y8w
PubMed36323675
UniProtQ22799|DYL1_CAEEL Dynein light chain 1, cytoplasmic (Gene Name=dlc-1)

[Back to BioLiP]