Structure of PDB 7xw6 Chain R

Receptor sequence

>7xw6R (length=562) Species: 9606 (Homo sapiens)

PCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPN
ISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPL
LKFLGIFNTGLKMFPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCN
ETLTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSG
PSLLDVSQTSVTALPSKGLEHLKELIARNTWTLKKLPLSLSFLHLTRADL
SYPIHCCAFKNQKEDMVCTPKSDEFNPCEDIMGYKFLRIVVWFVSLLALL
GNVFVLLILLTSHYKLNVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSE
YYNHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLD
RKIRLRHACAIMVGGWVCCFLLALLPLVGISSYAKVSICLPMDTETPLAL
AYIVFVLTLNIVAFVIVCCCYVKIYITVRNPDKDTKIAKRMAVLIFTDFI
CMAPISFYALSAILNKPLITVSNSKILLVLFYPLNSCANPFLYAIFTKAF
QRDVFILLSKFG

3D structure

• PDB: 7xw6 Hormone- and antibody-mediated activation of the thyrotropin receptor.
• Chain: R
• Resolution: 2.78 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLR	R	A627 V628	A492 V493
BS02	CLR	R	E506 Y510 T513 L589	E376 Y380 T383 L459
BS03	CLR	R	A638 L649	A503 L514
BS04	CLR	R	P639 F666	P504 F531
BS05	CLR	R	F416 I661 F666	F286 I526 F531
BS06	CLR	R	I419 F423	I289 F293
BS07	CLR	R	R418 W422 F423 L426	R288 W292 F293 L296
BS08	CLR	R	L427 F434 Q686	L297 F304 Q551
BS09	CLR	R	C598 C599	C468 C469
BS10	HOI	R	P571 M572 I583 V586 I640 A644 A647 I648 I654 V656 S659 L662 L663	P441 M442 I453 V456 I505 A509 A512 I513 I519 V521 S524 L527 L528

Gene Ontology

Molecular Function

• GO:0004930 G protein-coupled receptor activity
• GO:0004996 thyroid-stimulating hormone receptor activity
• GO:0005515 protein binding
• GO:0008528 G protein-coupled peptide receptor activity
• GO:0016500 protein-hormone receptor activity
• GO:0038023 signaling receptor activity
• GO:0044877 protein-containing complex binding

Biological Process

• GO:0007166 cell surface receptor signaling pathway
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
• GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
• GO:0007267 cell-cell signaling
• GO:0008284 positive regulation of cell population proliferation
• GO:0009755 hormone-mediated signaling pathway
• GO:0038194 thyroid-stimulating hormone signaling pathway
• GO:0120162 positive regulation of cold-induced thermogenesis
• GO:1904588 cellular response to glycoprotein
• GO:1905229 cellular response to thyrotropin-releasing hormone

Cellular Component

• GO:0005886 plasma membrane
• GO:0009986 cell surface
• GO:0016020 membrane
• GO:0016323 basolateral plasma membrane
• GO:0043235 receptor complex

External links

• PDB: RCSB:7xw6, PDBe:7xw6, PDBj:7xw6
• PDBsum: 7xw6
• PubMed: 35940204
• UniProt: P16473|TSHR_HUMAN Thyrotropin receptor (Gene Name=TSHR)