Structure of PDB 7xt8 Chain R |
>7xt8R (length=294) Species: 562,9606 [Search protein sequence] |
KVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLL VSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDR YYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIID LIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVT AKEHAHQIQMLQRAGASSETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFI DYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCC |
|
PDB | 7xt8 GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors. |
Chain | R |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
Biological Process |
GO:0007186 |
G protein-coupled receptor signaling pathway |
GO:0007187 |
G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger |
GO:0007188 |
adenylate cyclase-modulating G protein-coupled receptor signaling pathway |
GO:0007189 |
adenylate cyclase-activating G protein-coupled receptor signaling pathway |
GO:0007192 |
adenylate cyclase-activating serotonin receptor signaling pathway |
GO:0007268 |
chemical synaptic transmission |
GO:0022900 |
electron transport chain |
GO:0030277 |
maintenance of gastrointestinal epithelium |
GO:0032098 |
regulation of appetite |
GO:0070254 |
mucus secretion |
GO:0098664 |
G protein-coupled serotonin receptor signaling pathway |
GO:0120056 |
large intestinal transit |
GO:0150052 |
regulation of postsynapse assembly |
|
|