Structure of PDB 7xt8 Chain R

Receptor sequence
>7xt8R (length=294) Species: 562,9606 [Search protein sequence]
KVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLL
VSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDR
YYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIID
LIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVT
AKEHAHQIQMLQRAGASSETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFI
DYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCC
3D structure
PDB7xt8 GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
ChainR
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLR R F63 W145 F46 W128
BS02 CLR R V276 P289 V242 P255
BS03 CLR R W160 I163 Y191 W143 I146 Y174
BS04 SRO R D99 V100 T103 T104 C195 F274 N278 D82 V83 T86 T87 C178 F240 N244
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004993 G protein-coupled serotonin receptor activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0030594 neurotransmitter receptor activity
GO:0046872 metal ion binding
GO:0099589 serotonin receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007192 adenylate cyclase-activating serotonin receptor signaling pathway
GO:0007268 chemical synaptic transmission
GO:0022900 electron transport chain
GO:0030277 maintenance of gastrointestinal epithelium
GO:0032098 regulation of appetite
GO:0070254 mucus secretion
GO:0098664 G protein-coupled serotonin receptor signaling pathway
GO:0120056 large intestinal transit
GO:0150052 regulation of postsynapse assembly
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005886 plasma membrane
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0030425 dendrite
GO:0042597 periplasmic space
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xt8, PDBe:7xt8, PDBj:7xt8
PDBsum7xt8
PubMed35714614
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
Q13639

[Back to BioLiP]