Structure of PDB 7x5h Chain R

Receptor sequence
>7x5hR (length=274) Species: 562,9606 [Search protein sequence]
VFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDV
LVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIAL
DRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSE
GSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSREQK
EQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYS
NSFFNPLIYTAFNKNYNSAFKNFF
3D structure
PDB7x5h Structural insights into the ligand binding and G i coupling of serotonin receptor 5-HT 5A .
ChainR
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 8K3 R D121 C125 V194 S204 F301 F302 E305 D84 C88 V157 S167 F222 F223 E226
Gene Ontology
Molecular Function
GO:0001586 Gi/o-coupled serotonin receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004993 G protein-coupled serotonin receptor activity
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0030594 neurotransmitter receptor activity
GO:0046872 metal ion binding
GO:0051378 serotonin binding
GO:0099589 serotonin receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007198 adenylate cyclase-inhibiting serotonin receptor signaling pathway
GO:0007268 chemical synaptic transmission
GO:0021766 hippocampus development
GO:0022900 electron transport chain
GO:0032355 response to estradiol
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030425 dendrite
GO:0042597 periplasmic space
GO:0043204 perikaryon
GO:0099634 postsynaptic specialization membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7x5h, PDBe:7x5h, PDBj:7x5h
PDBsum7x5h
PubMed35610220
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
P47898|5HT5A_HUMAN 5-hydroxytryptamine receptor 5A (Gene Name=HTR5A)

[Back to BioLiP]