Structure of PDB 7wvv Chain R

Receptor sequence
>7wvvR (length=298) Species: 562,9606 [Search protein sequence]
SAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLA
LADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGF
IALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVT
IPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFLLPMSIVA
ICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWL
KEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHS
3D structure
PDB7wvv Structural basis of FPR2 in recognition of A beta 42 and neuroprotection by humanin.
ChainR
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R H102 D106 L109 F110 T177 F178 R201 R205 F257 G264 V284 H84 D88 L91 F92 T159 F160 R183 R187 F239 G246 V266
Gene Ontology
Molecular Function
GO:0001540 amyloid-beta binding
GO:0004875 complement receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004982 N-formyl peptide receptor activity
GO:0005124 scavenger receptor binding
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0038023 signaling receptor activity
GO:0038024 cargo receptor activity
GO:0046872 metal ion binding
Biological Process
GO:0001774 microglial cell activation
GO:0002430 complement receptor mediated signaling pathway
GO:0002768 immune response-regulating cell surface receptor signaling pathway
GO:0006898 receptor-mediated endocytosis
GO:0006935 chemotaxis
GO:0006954 inflammatory response
GO:0007155 cell adhesion
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0019722 calcium-mediated signaling
GO:0022900 electron transport chain
GO:0032930 positive regulation of superoxide anion generation
GO:0042742 defense response to bacterium
GO:0045089 positive regulation of innate immune response
GO:0048143 astrocyte activation
GO:0050728 negative regulation of inflammatory response
GO:0050766 positive regulation of phagocytosis
GO:0050918 positive chemotaxis
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0090026 positive regulation of monocyte chemotaxis
GO:1904646 cellular response to amyloid-beta
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0035579 specific granule membrane
GO:0042597 periplasmic space
GO:0070821 tertiary granule membrane
GO:0101003 ficolin-1-rich granule membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wvv, PDBe:7wvv, PDBj:7wvv
PDBsum7wvv
PubMed35365641
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
P25090|FPR2_HUMAN N-formyl peptide receptor 2 (Gene Name=FPR2)

[Back to BioLiP]