Structure of PDB 7wq4 Chain R

Receptor sequence
>7wq4R (length=282) Species: 9606 (Homo sapiens) [Search protein sequence]
HPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTTNLFILNLGVAD
LCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVSL
DRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLAN
LTVCHPAWSAPRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVAGS
GARRAKRKVTRMILIVAALFCLCWMPHHALILCVWFGQFPLTRATYALRI
LSHLVSYANSCVNPIVYALVSKHFRKGFRTIC
3D structure
PDB7wq4 Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
ChainR
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R D89 H102 L169 H176 P177 R184 F264 L266 T267 T270 Y271 R274 D68 H81 L148 H155 P156 R163 F239 L241 T242 T245 Y246 R249
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004966 galanin receptor activity
GO:0005515 protein binding
GO:0017046 peptide hormone binding
GO:0042923 neuropeptide binding
Biological Process
GO:0006936 muscle contraction
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007194 negative regulation of adenylate cyclase activity
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007218 neuropeptide signaling pathway
GO:0007611 learning or memory
GO:0007631 feeding behavior
GO:0031175 neuron projection development
GO:0043647 inositol phosphate metabolic process
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046488 phosphatidylinositol metabolic process
GO:0090663 galanin-activated signaling pathway
GO:1902608 positive regulation of large conductance calcium-activated potassium channel activity
Cellular Component
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wq4, PDBe:7wq4, PDBj:7wq4
PDBsum7wq4
PubMed
UniProtO43603|GALR2_HUMAN Galanin receptor type 2 (Gene Name=GALR2)

[Back to BioLiP]