Structure of PDB 7vla Chain R

Receptor sequence
>7vlaR (length=302) Species: 9606 (Homo sapiens) [Search protein sequence]
DYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLVQYKRLK
NMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTG
LYSEIFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASM
PGLYFSKTQWEFTHHTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMI
ICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQD
FLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQLF
HR
3D structure
PDB7vla Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
ChainR
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLR R N75 F112 W158 N59 F96 W142
Gene Ontology
Molecular Function
GO:0004435 phosphatidylinositol phospholipase C activity
GO:0004930 G protein-coupled receptor activity
GO:0004950 chemokine receptor activity
GO:0005515 protein binding
GO:0016493 C-C chemokine receptor activity
GO:0019957 C-C chemokine binding
GO:0035717 chemokine (C-C motif) ligand 7 binding
GO:0071791 chemokine (C-C motif) ligand 5 binding
Biological Process
GO:0002407 dendritic cell chemotaxis
GO:0002548 monocyte chemotaxis
GO:0006816 calcium ion transport
GO:0006874 intracellular calcium ion homeostasis
GO:0006887 exocytosis
GO:0006935 chemotaxis
GO:0006954 inflammatory response
GO:0006955 immune response
GO:0007155 cell adhesion
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007267 cell-cell signaling
GO:0009611 response to wounding
GO:0010629 negative regulation of gene expression
GO:0019221 cytokine-mediated signaling pathway
GO:0019722 calcium-mediated signaling
GO:0030335 positive regulation of cell migration
GO:0030502 negative regulation of bone mineralization
GO:0045672 positive regulation of osteoclast differentiation
GO:0051928 positive regulation of calcium ion transport
GO:0060326 cell chemotaxis
GO:0070098 chemokine-mediated signaling pathway
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0090026 positive regulation of monocyte chemotaxis
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0009897 external side of plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vla, PDBe:7vla, PDBj:7vla
PDBsum7vla
PubMed34949837
UniProtP32246|CCR1_HUMAN C-C chemokine receptor type 1 (Gene Name=CCR1)

[Back to BioLiP]