Structure of PDB 7vfx Chain R

Receptor sequence
>7vfxR (length=295) Species: 9606 (Homo sapiens) [Search protein sequence]
YLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVAD
FCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIAL
DRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKT
GTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSY
GLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIREL
LQGMYKEIGIAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHAL
3D structure
PDB7vfx Structural basis for recognition of N-formyl peptides as pathogen-associated molecular patterns.
ChainR
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R D106 F110 F178 R201 R205 Y257 D85 F89 F157 R180 R184 Y236
BS02 CLR R L118 V145 M152 L97 V124 M131
BS03 CLR R N66 K143 I146 W150 N45 K122 I125 W129
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0004875 complement receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004982 N-formyl peptide receptor activity
GO:0005124 scavenger receptor binding
GO:0005515 protein binding
GO:0050786 RAGE receptor binding
Biological Process
GO:0002430 complement receptor mediated signaling pathway
GO:0006935 chemotaxis
GO:0006954 inflammatory response
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007263 nitric oxide mediated signal transduction
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030667 secretory granule membrane
GO:0035577 azurophil granule membrane
GO:0101003 ficolin-1-rich granule membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vfx, PDBe:7vfx, PDBj:7vfx
PDBsum7vfx
PubMed36064945
UniProtP21462|FPR1_HUMAN fMet-Leu-Phe receptor (Gene Name=FPR1)

[Back to BioLiP]