Structure of PDB 7vab Chain R

Receptor sequence
>7vabR (length=288) Species: 9606 (Homo sapiens) [Search protein sequence]
QTAGELYQRWERYRRECQEFLDQRLILERLQVMYTVGYSLSLATLLLALL
ILSLFRRLHCTRNYIHINLFTSFMLRAAAILSRDRLLPRPLWNQALAACR
TAQIVTQYCVGANYTWLLVEGVYLHSLLVLVGGSEEGHFRYYLLLGWGAP
ALFVIPWVIVRYLYENTQCWERNEVKAIWWIIRTPILMTILINFLIFIRI
LGILLSKLRTRQDYRLRLARSTLFLVPLLGVHEVVFAPVEQARGALRFAK
LGFEIFLSSFQGFLVSVLYCFINKEVQSEIRRGWHHCR
3D structure
PDB7vab Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.
ChainR
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R Q30 F127 L134 Y141 R190 Q224 V227 E288 R289 N290 W296 E377 I378 Q1 F20 L27 Y34 R83 Q107 V110 E171 R172 N173 W179 E254 I255
BS02 CLR R R217 Y279 R100 Y162
BS03 CLR R N175 Y225 W264 N68 Y108 W147
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0005515 protein binding
GO:0008528 G protein-coupled peptide receptor activity
GO:0016519 gastric inhibitory peptide receptor activity
GO:0017046 peptide hormone binding
GO:0120022 glucagon family peptide binding
Biological Process
GO:0002029 desensitization of G protein-coupled receptor signaling pathway
GO:0006091 generation of precursor metabolites and energy
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190 activation of adenylate cyclase activity
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007584 response to nutrient
GO:0009749 response to glucose
GO:0031018 endocrine pancreas development
GO:0032024 positive regulation of insulin secretion
GO:0038192 gastric inhibitory peptide signaling pathway
GO:0043950 positive regulation of cAMP-mediated signaling
GO:0048678 response to axon injury
GO:0050796 regulation of insulin secretion
GO:0051592 response to calcium ion
GO:0070542 response to fatty acid
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vab, PDBe:7vab, PDBj:7vab
PDBsum7vab
PubMed35217653
UniProtP48546|GIPR_HUMAN Gastric inhibitory polypeptide receptor (Gene Name=GIPR)

[Back to BioLiP]