Structure of PDB 7v9s Chain R

Receptor sequence
>7v9sR (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]
KKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGE
ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
3D structure
PDB7v9s Columnar structure of human telomeric chromatin.
ChainR
Resolution11.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna R K25 R28 R30 K31 E32 S33 Y37 K2 R5 R7 K8 E9 S10 Y14
BS02 dna R K27 R30 E32 Y39 G50 I51 S52 S53 R83 S84 T85 K4 R7 E9 Y16 G27 I28 S29 S30 R60 S61 T62
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7v9s, PDBe:7v9s, PDBj:7v9s
PDBsum7v9s
PubMed36104563
UniProtO60814|H2B1K_HUMAN Histone H2B type 1-K (Gene Name=H2BC12)

[Back to BioLiP]