Structure of PDB 7uw1 Chain R

Receptor sequence

>7uw1R (length=109) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]

MEVTAKLRGAAISAQKARLVADLIRGKSVAHALNILNFSNKKAAVLVKKA
LESAIANAEHNNSLDVDDLKVSTIYVDEGMSLKRIMPRAKGRADRITKRT
CHITVKVGV

3D structure

PDB

7uw1 Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.

Chain

Resolution

2.21 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	T4 K6 R8 S13 Q15 K16 R18 R25 K41 K42 K49 S53 A56 N57 H60 N61 D77 E78 M80 R84 P87 R88 A89 K90 G91 R92 A93 D94 K98 H102	T4 K6 R8 S13 Q15 K16 R18 R25 K41 K42 K49 S53 A56 N57 H60 N61 D77 E78 M80 R84 P87 R88 A89 K90 G91 R92 A93 D94 K98 H102
BS02	OIY	R	G91 R92 A93	G91 R92 A93

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7uw1, PDBe:7uw1, PDBj:7uw1
PDBsum	7uw1
PubMed	37192172
UniProt	A0A009I821

[Back to BioLiP]