Structure of PDB 7ryh Chain R

Receptor sequence
>7ryhR (length=109) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
MEVTAKLRGAAISAQKARLVADLIRGKSVAHALNILNFSNKKAAVLVKKA
LESAIANAEHNNSLDVDDLKVSTIYVDEGMSLKRIMPRAKGRADRITKRT
CHITVKVGV
3D structure
PDB7ryh An Analysis of the Novel Fluorocycline TP-6076 Bound to Both the Ribosome and Multidrug Efflux Pump AdeJ from Acinetobacter baumannii.
ChainR
Resolution2.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R K6 R8 S13 Q15 K16 R18 K41 K42 K49 S53 A56 N57 H60 N61 Y75 D77 E78 M80 K83 R84 P87 R88 A89 K90 G91 R92 A93 D94 I96 K98 R99 K6 R8 S13 Q15 K16 R18 K41 K42 K49 S53 A56 N57 H60 N61 Y75 D77 E78 M80 K83 R84 P87 R88 A89 K90 G91 R92 A93 D94 I96 K98 R99
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ryh, PDBe:7ryh, PDBj:7ryh
PDBsum7ryh
PubMed35100868
UniProtA0A009I821

[Back to BioLiP]