Structure of PDB 7rkm Chain R

Receptor sequence

>7rkmR (length=294) Species: 10359 (Human betaherpesvirus 5)

DYDEDATPCVFTDVLNQSKPVTLFLYGVVFLFGSIGNFLVIFTITWRRRI
QCSGDVYFINLAAADLLFVCTLPLWMQYLLDHNSLASVPCTLLTACFYVA
MFASLCFITEIALDRYYAIVYMRYRPVKQACLFSIFWWIFAVIIAIPHFM
VVTKKDNQCMTDYDYLEVSYPIILNVELMLGAFVIPLSVISYCYYRISRI
VAVSQSRHKGRIVRVLIAVVLVFIIFWLPYHLTLFVDTLKLLKWISSSCE
FERSLKRALILTESLAFCHCCLNPLLYVFVGTKFRQELHCLLAE

3D structure

• PDB: 7rkm Atypical structural snapshots of human cytomegalovirus GPCR interactions with host G proteins
• Chain: R
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLR	R	L81 C145	L67 C131

Gene Ontology

Molecular Function

• GO:0004930 G protein-coupled receptor activity
• GO:0004950 chemokine receptor activity
• GO:0005515 protein binding
• GO:0016493 C-C chemokine receptor activity
• GO:0019957 C-C chemokine binding

Biological Process

• GO:0006935 chemotaxis
• GO:0006955 immune response
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007204 positive regulation of cytosolic calcium ion concentration
• GO:0019049 virus-mediated perturbation of host defense response
• GO:0019722 calcium-mediated signaling
• GO:0044864 positive regulation by virus of host cell division
• GO:0060326 cell chemotaxis
• GO:0070098 chemokine-mediated signaling pathway

Cellular Component

• GO:0009897 external side of plasma membrane
• GO:0016020 membrane
• GO:0020002 host cell plasma membrane

External links

• PDB: RCSB:7rkm, PDBe:7rkm, PDBj:7rkm
• PDBsum: 7rkm
• UniProt: P69332|US28_HCMVA G-protein coupled receptor homolog US28 (Gene Name=US28)