Structure of PDB 7rh6 Chain R

Receptor sequence

>7rh6R (length=552) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

ELEARRPFPERMGPKGNLIYKLITTTDHKLIGIMYCVVCFAFFLVGGLMA
LFMRTELAMPGLQFLSNEQFNQLFTMHGTVMLLFYATPIVFGFANLVLPL
QIGAPDVAFPRLNALSFWLFLFGALIAIAGFITPGGAADFGWTAYSPLTD
AIHSPGAGGDLWIMGLAVGGLGTILGGVNMITTVVCMRAPGMTMFRMPIF
TWNILVTSILVLIAFPILTAALFGLAADRHLGAHIYDPANGGVLLWQHLF
WFFGHPEVYIIALPFFGIVSEIFPVFSRKPIFGYTTLIYATLAIAALSVA
VWAHHMYATGAVLLPFFSFMTFLIAVPTGIKFFNWIGTMWKGQLTFETPM
LFSVGFLITFLLGGLSGVLLASPPLDFHVTDSYFVIAHFHYVLFGTIVFA
TYAGIYFWFPKMTGRLLDERLGKLHFWLTFIGFHTTFLVQHWLGDEGMPR
RYADYLPTDGFTTLNVISTVGAFILGVSMLPFVWNVFKSWRYGEPVTVDD
PWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYPHMVERMRAEAH
VG

3D structure

• PDB: 7rh6 Structure of mycobacterial CIII 2 CIV 2 respiratory supercomplex bound to the tuberculosis drug candidate telacebec (Q203).
• Chain: R
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	R	H264 H313 H314	H255 H304 H305
BS02	HEA	R	V267 Y268 H313 H314 G338 G373 G376 L379 D385 T389 V394 H397 F398 V401 L402 R459	V258 Y259 H304 H305 G329 G364 G367 L370 D376 T380 V385 H388 F389 V392 L393 R450
BS03	HEA	R	F52 L53 G56 L57 A59 R63 F79 F83 H86 M90 L91 G150 Y392 F398 H399 F403 F446 R459 R460 L484	F43 L44 G47 L48 A50 R54 F70 F74 H77 M81 L82 G141 Y383 F389 H390 F394 F437 R450 R451 L475
BS04	9Y0	R	M173 F232 A235 A236 L240	M164 F223 A226 A227 L231
BS05	MQ9	R	F131 A138	F122 A129

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 17:35:18 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7rh6', asym_id = 'R', title = 'Structure of mycobacterial CIII 2 CIV 2 respirat...the tuberculosis drug candidate telacebec (Q203).'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7rh6', asym_id='R', title='Structure of mycobacterial CIII 2 CIV 2 respirat...the tuberculosis drug candidate telacebec (Q203).')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004129,0009060,0015990,0016020,0020037', uniprot = '', pdbid = '7rh6', asym_id = 'R'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004129,0009060,0015990,0016020,0020037', uniprot='', pdbid='7rh6', asym_id='R')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>