Structure of PDB 7r72 Chain R

Receptor sequence

>7r72R (length=134) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIV
KKAVTVHSKRLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLYHVLYKESK
GNAFKHKRALVEHIIQAKADAQREKALNEEAEAR

3D structure

PDB

7r72 Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

Chain

Resolution

3.07 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	A2 N3 R5 T6 K8 R9 L10 V17 K19 R20 K21 W23 L24 P26 S37 R38 N39 R42 K43 K46 K53 V57 H58 R88 L89 P90 Q92 W95 I96 R100 V101 R103 R104 K108 Y109 R110 H118 Y120 H121 Y124 K125 K128 G129 H134 K135 R136	A1 N2 R4 T5 K7 R8 L9 V16 K18 R19 K20 W22 L23 P25 S36 R37 N38 R41 K42 K45 K52 V56 H57 R60 L61 P62 Q64 W67 I68 R72 V73 R75 R76 K80 Y81 R82 H90 Y92 H93 Y96 K97 K100 G101 H106 K107 R108

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7r72, PDBe:7r72, PDBj:7r72
PDBsum	7r72
PubMed	36482249
UniProt	P0CX82\|RL19A_YEAST Large ribosomal subunit protein eL19A (Gene Name=RPL19A)