Structure of PDB 7pic Chain R

Receptor sequence
>7picR (length=84) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
RSAKKGAFVDAHLLKKVIDMNKQEKKRPIKTWSRRSTIFPEFVGNTFAVH
NGKTFINVYVTDDMVGHKLGEFSPTRNFKQHTAN
3D structure
PDB7pic Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainR
Resolution9.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R R3 S4 A5 K6 F10 H14 L15 K17 K18 K32 W34 S35 R36 R37 H52 N53 G54 K55 K70 G72 E73 T77 R78 N79 F80 K81 R1 S2 A3 K4 F8 H12 L13 K15 K16 K30 W32 S33 R34 R35 H50 N51 G52 K53 K68 G70 E71 T75 R76 N77 F78 K79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pic, PDBe:7pic, PDBj:7pic
PDBsum7pic
PubMed36171285
UniProtP75576|RS19_MYCPN Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]