Structure of PDB 7o3e Chain R

Receptor sequence
>7o3eR (length=72) Species: 10090 (Mus musculus) [Search protein sequence]
EFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPF
VVVYLIYTWGNQEFEQSKRKNP
3D structure
PDB7o3e Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
ChainR
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R Y16 L18 E22 Q23 R24 P27 Y14 L16 E20 Q21 R22 P25
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0021539 subthalamus development
GO:0021548 pons development
GO:0021680 cerebellar Purkinje cell layer development
GO:0021766 hippocampus development
GO:0021794 thalamus development
GO:0021854 hypothalamus development
GO:0021860 pyramidal neuron development
GO:0030901 midbrain development
GO:0045333 cellular respiration
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045275 respiratory chain complex III

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o3e, PDBe:7o3e, PDBj:7o3e
PDBsum7o3e
PubMed34616041
UniProtQ9CQ69|QCR8_MOUSE Cytochrome b-c1 complex subunit 8 (Gene Name=Uqcrq)

[Back to BioLiP]