Structure of PDB 7nhl Chain R

Receptor sequence
>7nhlR (length=118) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
ISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGV
TLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLY
HGRVKALAEAARESGLEF
3D structure
PDB7nhl Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
ChainR
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R S3 R14 R17 F94 R96 Y101 R113 S2 R13 R16 F93 R95 Y100 R112
BS02 rna R K4 D6 K7 R11 H15 R19 R30 N32 Y34 R35 S36 N37 K38 Y41 Q43 G50 Q55 K59 K69 H102 G103 R104 K3 D5 K6 R10 H14 R18 R29 N31 Y33 R34 S35 N36 K37 Y40 Q42 G49 Q54 K58 K68 H101 G102 R103
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nhl, PDBe:7nhl, PDBj:7nhl
PDBsum7nhl
PubMed34117249
UniProtQ2FW22|RL18_STAA8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]