Structure of PDB 7msm Chain R

Receptor sequence
>7msmR (length=100) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
TYAIVKTGGKQYKVAVGDVVKVEKLESEQGEKVSLPVALVVDGATVTTDA
KALAKVAVTGEVLGHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVTGI
3D structure
PDB7msm Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
ChainR
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R G11 K13 K27 K73 I74 I76 K78 K80 N81 K82 Y85 K87 R88 G90 H91 R92 Q93 G8 K10 K24 K70 I71 I73 K75 K77 N78 K79 Y82 K84 R85 G87 H88 R89 Q90
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7msm, PDBe:7msm, PDBj:7msm
PDBsum7msm
PubMed35064151
UniProtP9WHC3|RL21_MYCTU Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]