Structure of PDB 7jvr Chain R

Receptor sequence
>7jvrR (length=269) Species: 562,9606 [Search protein sequence]
YNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLV
ATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRY
TAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECI
IANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTQQKEKKAT
QMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVN
PIIYTTFNIEFRKAFLKIL
3D structure
PDB7jvr Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
ChainR
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 08Y R F110 C118 T119 I184 S197 F389 F390 F77 C85 T86 I151 S164 F217 F218
Gene Ontology
Molecular Function
GO:0001591 dopamine neurotransmitter receptor activity, coupled via Gi/Go
GO:0001965 G-protein alpha-subunit binding
GO:0004930 G protein-coupled receptor activity
GO:0004952 dopamine neurotransmitter receptor activity
GO:0005102 signaling receptor binding
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0032795 heterotrimeric G-protein binding
GO:0035240 dopamine binding
GO:0035255 ionotropic glutamate receptor binding
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
GO:0046872 metal ion binding
GO:0097159 organic cyclic compound binding
GO:1901363 heterocyclic compound binding
Biological Process
GO:0001659 temperature homeostasis
GO:0001666 response to hypoxia
GO:0001764 neuron migration
GO:0001964 startle response
GO:0001975 response to amphetamine
GO:0001976 nervous system process involved in regulation of systemic arterial blood pressure
GO:0002027 regulation of heart rate
GO:0002028 regulation of sodium ion transport
GO:0002031 G protein-coupled receptor internalization
GO:0002052 positive regulation of neuroblast proliferation
GO:0002092 positive regulation of receptor internalization
GO:0006914 autophagy
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007195 adenylate cyclase-inhibiting dopamine receptor signaling pathway
GO:0007212 G protein-coupled dopamine receptor signaling pathway
GO:0007270 neuron-neuron synaptic transmission
GO:0007405 neuroblast proliferation
GO:0007409 axonogenesis
GO:0007416 synapse assembly
GO:0007608 sensory perception of smell
GO:0007616 long-term memory
GO:0007625 grooming behavior
GO:0007626 locomotory behavior
GO:0007628 adult walking behavior
GO:0007631 feeding behavior
GO:0008104 protein localization
GO:0008283 cell population proliferation
GO:0008285 negative regulation of cell population proliferation
GO:0008306 associative learning
GO:0008542 visual learning
GO:0009410 response to xenobiotic stimulus
GO:0009416 response to light stimulus
GO:0009636 response to toxic substance
GO:0010039 response to iron ion
GO:0014059 regulation of dopamine secretion
GO:0014854 response to inactivity
GO:0016055 Wnt signaling pathway
GO:0016477 cell migration
GO:0021756 striatum development
GO:0021769 orbitofrontal cortex development
GO:0021853 cerebral cortex GABAergic interneuron migration
GO:0021984 adenohypophysis development
GO:0022900 electron transport chain
GO:0030336 negative regulation of cell migration
GO:0030432 peristalsis
GO:0030534 adult behavior
GO:0030900 forebrain development
GO:0031223 auditory behavior
GO:0032228 regulation of synaptic transmission, GABAergic
GO:0032355 response to estradiol
GO:0032467 positive regulation of cytokinesis
GO:0032922 circadian regulation of gene expression
GO:0033602 negative regulation of dopamine secretion
GO:0034776 response to histamine
GO:0035094 response to nicotine
GO:0035810 positive regulation of urine volume
GO:0035815 positive regulation of renal sodium excretion
GO:0040018 positive regulation of multicellular organism growth
GO:0042220 response to cocaine
GO:0042321 negative regulation of circadian sleep/wake cycle, sleep
GO:0042417 dopamine metabolic process
GO:0042756 drinking behavior
GO:0043266 regulation of potassium ion transport
GO:0043278 response to morphine
GO:0043408 regulation of MAPK cascade
GO:0043410 positive regulation of MAPK cascade
GO:0043473 pigmentation
GO:0043491 phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0045471 response to ethanol
GO:0045745 positive regulation of G protein-coupled receptor signaling pathway
GO:0045776 negative regulation of blood pressure
GO:0045824 negative regulation of innate immune response
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046676 negative regulation of insulin secretion
GO:0046717 acid secretion
GO:0048148 behavioral response to cocaine
GO:0048149 behavioral response to ethanol
GO:0048169 regulation of long-term neuronal synaptic plasticity
GO:0048678 response to axon injury
GO:0048755 branching morphogenesis of a nerve
GO:0050482 arachidonate secretion
GO:0050673 epithelial cell proliferation
GO:0050680 negative regulation of epithelial cell proliferation
GO:0050709 negative regulation of protein secretion
GO:0050769 positive regulation of neurogenesis
GO:0050804 modulation of chemical synaptic transmission
GO:0050805 negative regulation of synaptic transmission
GO:0051209 release of sequestered calcium ion into cytosol
GO:0051481 negative regulation of cytosolic calcium ion concentration
GO:0051580 regulation of neurotransmitter uptake
GO:0051583 dopamine uptake involved in synaptic transmission
GO:0051584 regulation of dopamine uptake involved in synaptic transmission
GO:0051586 positive regulation of dopamine uptake involved in synaptic transmission
GO:0051823 regulation of synapse structural plasticity
GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0051967 negative regulation of synaptic transmission, glutamatergic
GO:0060079 excitatory postsynaptic potential
GO:0060124 positive regulation of growth hormone secretion
GO:0060134 prepulse inhibition
GO:0060158 phospholipase C-activating dopamine receptor signaling pathway
GO:0060160 negative regulation of dopamine receptor signaling pathway
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0071300 cellular response to retinoic acid
GO:0071361 cellular response to ethanol
GO:0071880 adenylate cyclase-activating adrenergic receptor signaling pathway
GO:0090325 regulation of locomotion involved in locomotory behavior
GO:0099170 postsynaptic modulation of chemical synaptic transmission
GO:0099171 presynaptic modulation of chemical synaptic transmission
GO:1900038 negative regulation of cellular response to hypoxia
GO:1900168 positive regulation of glial cell-derived neurotrophic factor production
GO:1900273 positive regulation of long-term synaptic potentiation
GO:1901386 negative regulation of voltage-gated calcium channel activity
GO:1903530 regulation of secretion by cell
GO:1990384 hyaloid vascular plexus regression
GO:2001223 negative regulation of neuron migration
Cellular Component
GO:0000139 Golgi membrane
GO:0001669 acrosomal vesicle
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0016020 membrane
GO:0016328 lateral plasma membrane
GO:0030139 endocytic vesicle
GO:0030424 axon
GO:0030425 dendrite
GO:0030672 synaptic vesicle membrane
GO:0036126 sperm flagellum
GO:0042597 periplasmic space
GO:0042734 presynaptic membrane
GO:0043197 dendritic spine
GO:0043204 perikaryon
GO:0043679 axon terminus
GO:0045211 postsynaptic membrane
GO:0060170 ciliary membrane
GO:0097648 G protein-coupled receptor complex
GO:0097730 non-motile cilium
GO:0098691 dopaminergic synapse
GO:0098978 glutamatergic synapse
GO:0098982 GABA-ergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7jvr, PDBe:7jvr, PDBj:7jvr
PDBsum7jvr
PubMed33571431
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
P14416|DRD2_HUMAN D(2) dopamine receptor (Gene Name=DRD2)

[Back to BioLiP]