Structure of PDB 7jvp Chain R

Receptor sequence
>7jvpR (length=280) Species: 9606 (Homo sapiens) [Search protein sequence]
FSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVS
DLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISV
DRYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPN
CDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAA
VHAKFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGCIDSNTFDVF
VWFGWANSSLNPIIYAFNADFRKAFSTLLG
3D structure
PDB7jvp Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
ChainR
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SK9 R V100 D103 I104 S107 S188 L190 S198 S202 F288 F289 N292 W321 V81 D84 I85 S88 S153 L155 S163 S167 F229 F230 N233 W255 BindingDB: Ki=1.18nM,EC50=>10000nM
BS02 CLR R Y204 C293 F297 Y169 C234 F238
BS03 CLR R K272 S275 K213 S216
BS04 CLR R F95 I98 F76 I79
BS05 CLR R I98 V152 F156 Q160 I79 V133 F137 Q141
BS06 CLR R R55 F61 V68 F141 W148 R36 F42 V49 F122 W129
Gene Ontology
Molecular Function
GO:0001588 dopamine neurotransmitter receptor activity, coupled via Gs
GO:0001965 G-protein alpha-subunit binding
GO:0004930 G protein-coupled receptor activity
GO:0004952 dopamine neurotransmitter receptor activity
GO:0005515 protein binding
GO:0032795 heterotrimeric G-protein binding
GO:0035240 dopamine binding
GO:1990763 arrestin family protein binding
Biological Process
GO:0001659 temperature homeostasis
GO:0001661 conditioned taste aversion
GO:0001662 behavioral fear response
GO:0001764 neuron migration
GO:0001963 synaptic transmission, dopaminergic
GO:0001975 response to amphetamine
GO:0006606 protein import into nucleus
GO:0006936 muscle contraction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190 activation of adenylate cyclase activity
GO:0007191 adenylate cyclase-activating dopamine receptor signaling pathway
GO:0007212 G protein-coupled dopamine receptor signaling pathway
GO:0007416 synapse assembly
GO:0007612 learning
GO:0007613 memory
GO:0007617 mating behavior
GO:0007625 grooming behavior
GO:0007626 locomotory behavior
GO:0007628 adult walking behavior
GO:0007631 feeding behavior
GO:0008306 associative learning
GO:0008542 visual learning
GO:0009410 response to xenobiotic stimulus
GO:0014002 astrocyte development
GO:0015872 dopamine transport
GO:0016477 cell migration
GO:0019226 transmission of nerve impulse
GO:0019228 neuronal action potential
GO:0021542 dentate gyrus development
GO:0021756 striatum development
GO:0021766 hippocampus development
GO:0021853 cerebral cortex GABAergic interneuron migration
GO:0030335 positive regulation of cell migration
GO:0030432 peristalsis
GO:0035106 operant conditioning
GO:0035249 synaptic transmission, glutamatergic
GO:0042053 regulation of dopamine metabolic process
GO:0042220 response to cocaine
GO:0042311 vasodilation
GO:0042417 dopamine metabolic process
GO:0042711 maternal behavior
GO:0043268 positive regulation of potassium ion transport
GO:0043410 positive regulation of MAPK cascade
GO:0046323 D-glucose import
GO:0046959 habituation
GO:0046960 sensitization
GO:0048148 behavioral response to cocaine
GO:0051281 positive regulation of release of sequestered calcium ion into cytosol
GO:0051584 regulation of dopamine uptake involved in synaptic transmission
GO:0051968 positive regulation of synaptic transmission, glutamatergic
GO:0060134 prepulse inhibition
GO:0060158 phospholipase C-activating dopamine receptor signaling pathway
GO:0060291 long-term synaptic potentiation
GO:0060292 long-term synaptic depression
GO:0071870 cellular response to catecholamine stimulus
GO:0071880 adenylate cyclase-activating adrenergic receptor signaling pathway
GO:0099010 modification of postsynaptic structure
GO:0099171 presynaptic modulation of chemical synaptic transmission
GO:2001224 positive regulation of neuron migration
Cellular Component
GO:0005634 nucleus
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0030425 dendrite
GO:0042734 presynaptic membrane
GO:0042995 cell projection
GO:0043197 dendritic spine
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:0060170 ciliary membrane
GO:0097648 G protein-coupled receptor complex
GO:0097730 non-motile cilium
GO:0098978 glutamatergic synapse
GO:0098982 GABA-ergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7jvp, PDBe:7jvp, PDBj:7jvp
PDBsum7jvp
PubMed33571431
UniProtP21728|DRD1_HUMAN D(1A) dopamine receptor (Gene Name=DRD1)

[Back to BioLiP]