Structure of PDB 7fin Chain R

Receptor sequence
>7finR (length=380) Species: 9606 (Homo sapiens) [Search protein sequence]
QTAGELYQRWERYRRECQETLAAAACNGSFDMYVCWDYAAPNATARASCP
WYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILE
RLQVMYTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSFMLRAA
AILSRDRLLPRPGPYLGDQALALWNQALAACRTAQIVTQYCVGANYTWLL
VEGVYLHSLLVLVGGSEEGHFRYYLLLGWGAPALFVIPWVIVRYLYENTQ
CWERNEVKAIWWIIRTPILMTILINFLIFIRILGILLSKLRTRQMRCRDY
RLRLARSTLFLVPLLGVHEVVFAPVTEEQARGALRFAKLGFEIFLSSFQG
FLVSVLYCFINKEVQSEIRRGWHHCRLRRS
3D structure
PDB7fin Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.
ChainR
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLR R L318 L322 L283 L287
BS02 CLR R R217 Y279 R182 Y244
BS03 CLR R W297 T301 W262 T266
BS04 CLR R Y225 W264 Y190 W229
BS05 GGL R E135 Q138 E100 Q103
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0005515 protein binding
GO:0008528 G protein-coupled peptide receptor activity
GO:0016519 gastric inhibitory peptide receptor activity
GO:0017046 peptide hormone binding
GO:0120022 glucagon family peptide binding
Biological Process
GO:0002029 desensitization of G protein-coupled receptor signaling pathway
GO:0006091 generation of precursor metabolites and energy
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190 activation of adenylate cyclase activity
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007584 response to nutrient
GO:0009749 response to glucose
GO:0031018 endocrine pancreas development
GO:0032024 positive regulation of insulin secretion
GO:0038192 gastric inhibitory peptide signaling pathway
GO:0043950 positive regulation of cAMP-mediated signaling
GO:0048678 response to axon injury
GO:0050796 regulation of insulin secretion
GO:0051592 response to calcium ion
GO:0070542 response to fatty acid
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7fin, PDBe:7fin, PDBj:7fin
PDBsum7fin
PubMed35217653
UniProtP48546|GIPR_HUMAN Gastric inhibitory polypeptide receptor (Gene Name=GIPR)

[Back to BioLiP]