Structure of PDB 7fih Chain R

Receptor sequence
>7fihR (length=550) Species: 9606 (Homo sapiens) [Search protein sequence]
TRLSLAYLPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLS
EILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVTKVFSSESNF
ILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTS
LELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIAT
SSYSLKKLPSRETFVNLLEATLTYPIHCCAFRNLPDYEYGFCLPKTPRCA
PEPDAFNPCEDIMGYDFLRVLIWLINILAIMGNMTVLFVLLTSRYKLTVP
RFLMCNLSFADFCMGLYLLLIASVDSQTKGQYYNHAIDWQTGSGCSTAGF
FTVFASELSVYTLTVITLERWHTITYAIHLDQKLRLRHAILIMLGGWLFS
SLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFFIICA
CYIKIYFAVRNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAF
KVPLITVTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFGCC
3D structure
PDB7fih Structures of full-length glycoprotein hormone receptor signalling complexes.
ChainR
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 55Z R F350 F515 P516 M517 I528 A592 K595 V601 S604 F256 F421 P422 M423 I434 A498 K501 V507 S510
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004964 luteinizing hormone receptor activity
GO:0008528 G protein-coupled peptide receptor activity
GO:0016500 protein-hormone receptor activity
GO:0017046 peptide hormone binding
GO:0035472 choriogonadotropin hormone receptor activity
GO:0038106 choriogonadotropin hormone binding
GO:0042802 identical protein binding
GO:0051117 ATPase binding
Biological Process
GO:0001541 ovarian follicle development
GO:0006622 protein targeting to lysosome
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190 activation of adenylate cyclase activity
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007283 spermatogenesis
GO:0008584 male gonad development
GO:0008585 female gonad development
GO:0009410 response to xenobiotic stimulus
GO:0009755 hormone-mediated signaling pathway
GO:0010524 positive regulation of calcium ion transport into cytosol
GO:0022602 ovulation cycle process
GO:0030539 male genitalia development
GO:0032962 positive regulation of inositol trisphosphate biosynthetic process
GO:0034699 response to luteinizing hormone
GO:0042700 luteinizing hormone signaling pathway
GO:0046544 development of secondary male sexual characteristics
GO:0046886 positive regulation of hormone biosynthetic process
GO:0050482 arachidonate secretion
GO:0050810 regulation of steroid biosynthetic process
GO:0050850 positive regulation of calcium-mediated signaling
GO:0050890 cognition
GO:0051281 positive regulation of release of sequestered calcium ion into cytosol
GO:0060065 uterus development
GO:0071371 cellular response to gonadotropin stimulus
GO:0071373 cellular response to luteinizing hormone stimulus
GO:0072520 seminiferous tubule development
GO:0090030 regulation of steroid hormone biosynthetic process
Cellular Component
GO:0005615 extracellular space
GO:0005768 endosome
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0034451 centriolar satellite
GO:0043235 receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7fih, PDBe:7fih, PDBj:7fih
PDBsum7fih
PubMed34552239
UniProtP22888|LSHR_HUMAN Lutropin-choriogonadotropic hormone receptor (Gene Name=LHCGR)

[Back to BioLiP]