Structure of PDB 7f8w Chain R

Receptor sequence
>7f8wR (length=275) Species: 9606 (Homo sapiens) [Search protein sequence]
AIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLA
VACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYS
AICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQ
CVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLLAKKR
VVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSY
ASACVNPLVYCFMHRRFRQACLETC
3D structure
PDB7f8w Structures of the human cholecystokinin receptors bound to agonists and antagonists.
ChainR
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R P114 N115 M134 V138 Y189 Q204 V206 H207 R356 H364 I372 H376 P60 N61 M80 V84 Y135 Q150 V152 H153 R226 H234 I242 H246
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004951 cholecystokinin receptor activity
GO:0005515 protein binding
GO:0015054 gastrin receptor activity
GO:0017046 peptide hormone binding
GO:0031741 type B gastrin/cholecystokinin receptor binding
GO:0046935 1-phosphatidylinositol-3-kinase regulator activity
Biological Process
GO:0001696 gastric acid secretion
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0008284 positive regulation of cell population proliferation
GO:0038188 cholecystokinin signaling pathway
GO:0045851 pH reduction
GO:0048565 digestive tract development
GO:0048732 gland development
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f8w, PDBe:7f8w, PDBj:7f8w
PDBsum7f8w
PubMed34556863
UniProtP32239|GASR_HUMAN Gastrin/cholecystokinin type B receptor (Gene Name=CCKBR)

[Back to BioLiP]