Structure of PDB 7f58 Chain R

Receptor sequence
>7f58R (length=273) Species: 9606 (Homo sapiens) [Search protein sequence]
GCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAV
ADMLVSVSNGSETIVITLLNSTSFTVNIDNVIDSVICSSLLASICSLLSI
AVDRYFTIFYALQYHNIMTVKRVGIIISCIWAACTVSGILFIIYSDSSAV
IICLITMFFTMLALMASLYVHMFLMARLHIKRIAVLPGTQGANMKGAITL
TILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSII
DPLIYALRSQELRKTFKEIICCY
3D structure
PDB7f58 Structural insights into ligand recognition and activation of the melanocortin-4 receptor.
ChainR
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 1I8 R F45 E100 D126 I129 C130 S188 L197 F261 H264 L265 Y268 F284 F7 E62 D83 I86 C87 S145 L154 F214 H217 L218 Y221 F237 BindingDB: IC50=1.2nM,EC50=3.6nM,Ki=3nM
BS02 CA R E100 D122 D126 E62 D79 D83
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004977 melanocortin receptor activity
GO:0004980 melanocyte-stimulating hormone receptor activity
GO:0005515 protein binding
GO:0017046 peptide hormone binding
GO:0031625 ubiquitin protein ligase binding
GO:0042562 hormone binding
GO:0042923 neuropeptide binding
Biological Process
GO:0002024 diet induced thermogenesis
GO:0006112 energy reserve metabolic process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007631 feeding behavior
GO:0019222 regulation of metabolic process
GO:0030073 insulin secretion
GO:0032868 response to insulin
GO:0045780 positive regulation of bone resorption
GO:0060259 regulation of feeding behavior
GO:1903925 response to bisphenol A
GO:1903998 regulation of eating behavior
GO:1990680 response to melanocyte-stimulating hormone
GO:2000252 negative regulation of feeding behavior
GO:2000821 regulation of grooming behavior
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f58, PDBe:7f58, PDBj:7f58
PDBsum7f58
PubMed34433901
UniProtP32245|MC4R_HUMAN Melanocortin receptor 4 (Gene Name=MC4R)

[Back to BioLiP]