Structure of PDB 7ew4 Chain R

Receptor sequence
>7ew4R (length=287) Species: 9606 (Homo sapiens) [Search protein sequence]
ETLREHYQYVGKLSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMY
FFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFVALGAS
TCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILG
WNCLHNLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSS
SRKVANHNNSERSMALLRTVVIVVSVFIACWSPLFILFLIDVACRVQACP
ILFKAQWFIVLAVLNSAMNPVIYTLASKEMRRAFFRL
3D structure
PDB7ew4 Structural insights into sphingosine-1-phosphate recognition and ligand selectivity of S1PR3-Gi signaling complexes.
ChainR
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 JF9 R F119 L122 C200 I201 I203 L259 F263 F94 L97 C175 I176 I178 L234 F238 BindingDB: EC50=105nM
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0005178 integrin binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0038036 sphingosine-1-phosphate receptor activity
Biological Process
GO:0003376 sphingosine-1-phosphate receptor signaling pathway
GO:0006954 inflammatory response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007219 Notch signaling pathway
GO:0008284 positive regulation of cell population proliferation
GO:0009653 anatomical structure morphogenesis
GO:0019222 regulation of metabolic process
GO:0032651 regulation of interleukin-1 beta production
GO:1903141 negative regulation of establishment of endothelial barrier
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0098793 presynapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ew4, PDBe:7ew4, PDBj:7ew4
PDBsum7ew4
PubMed34545189
UniProtQ99500|S1PR3_HUMAN Sphingosine 1-phosphate receptor 3 (Gene Name=S1PR3)

[Back to BioLiP]