Structure of PDB 7e14 Chain R

Receptor sequence

>7e14R (length=375) Species: 9606 (Homo sapiens) [Search protein sequence]

TVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPG
SFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEE
SSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIHLNLF
ASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQ
YCVAANYYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPW
GIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSK
LKADIKCRLAKSTLTLIPLLGTHEVIFAGTLRFIKLFTELSFTSFQGLMV
AILYCFVNNEVQLEFRKSWERWRLE

3D structure

PDB

7e14 Molecular insights into ago-allosteric modulation of the human glucagon-like peptide-1 receptor.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	V6G	R	S31 E34 E138 L141 L144 Y145 Y148 K197 D198 A200 L201 K202 Y205 Y220 C226 V229 F230 M233 T298	S3 E6 E104 L107 L110 Y111 Y114 K163 D164 A166 L167 K168 Y171 Y186 C192 V195 F196 M199 T264	BindingDB: EC50=600nM
BS02	CLR	R	Y235 L278	Y201 L244
BS03	CLR	R	L189 F266 W274	L155 F232 W240
BS04	CLR	R	L349 A350	L309 A310
BS05	CLR	R	I328 C329 T362	I294 C295 T322
BS06	CLR	R	L181 A185	L147 A151

Gene Ontology

	Molecular Function
GO:0004888	transmembrane signaling receptor activity
GO:0004930	G protein-coupled receptor activity
GO:0004967	glucagon receptor activity
GO:0005515	protein binding
GO:0017046	peptide hormone binding
GO:0038023	signaling receptor activity
GO:0044508	glucagon-like peptide 1 receptor activity

	Biological Process
GO:0007166	cell surface receptor signaling pathway
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190	activation of adenylate cyclase activity
GO:0007204	positive regulation of cytosolic calcium ion concentration
GO:0007611	learning or memory
GO:0008016	regulation of heart contraction
GO:0019933	cAMP-mediated signaling
GO:0031204	post-translational protein targeting to membrane, translocation
GO:0045776	negative regulation of blood pressure
GO:0045777	positive regulation of blood pressure
GO:0046879	hormone secretion
GO:0071377	cellular response to glucagon stimulus
GO:1990911	response to psychosocial stress

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7e14, PDBe:7e14, PDBj:7e14
PDBsum	7e14
PubMed	34145245
UniProt	P43220\|GLP1R_HUMAN Glucagon-like peptide 1 receptor (Gene Name=GLP1R)

[Back to BioLiP]