Structure of PDB 7ddq Chain R

Receptor sequence
>7ddqR (length=44) Species: 1185920 (Phaeovulum veldkampii DSM 11550) [Search protein sequence]
DLSFTGLTDQQAQELHSVYLQGMWLFISVAIVAHLAVFIWRPWL
3D structure
PDB7ddq Cryo-EM structure of the photosynthetic RC-LH1-PufX supercomplex at 2.8-angstrom resolution.
ChainR
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 BCL R F30 A34 H38 V41 W44 F26 A30 H34 V37 W40
BS02 SPO R Y23 M27 Y19 M23
BS03 BCL R F30 A34 H38 V41 F42 W47 F26 A30 H34 V37 F38 W43
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ddq, PDBe:7ddq, PDBj:7ddq
PDBsum7ddq
PubMed34134992
UniProtA0A2T4JIL7

[Back to BioLiP]