Structure of PDB 7b93 Chain R

Receptor sequence

>7b93R (length=96) Species: 10090 (Mus musculus) [Search protein sequence]

GVQVSPSGEKITHTGQVYDEKDYRRVRFVDRQKEVNENFAIDLIAQQPVN
EVEHRIIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFKQHHH

3D structure

PDB

7b93 Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.

Chain

Resolution

3.04 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	R	C59 H68 C84 C87	C59 H68 C84 C87

Gene Ontology

	Molecular Function
GO:0003674	molecular_function

	Biological Process
GO:0001822	kidney development
GO:0006120	mitochondrial electron transport, NADH to ubiquinone
GO:0006631	fatty acid metabolic process
GO:0006936	muscle contraction
GO:0007005	mitochondrion organization
GO:0009060	aerobic respiration
GO:0010467	gene expression
GO:0017145	stem cell division
GO:0022904	respiratory electron transport chain
GO:0030330	DNA damage response, signal transduction by p53 class mediator
GO:0032981	mitochondrial respiratory chain complex I assembly
GO:0035264	multicellular organism growth
GO:0042391	regulation of membrane potential
GO:0042776	proton motive force-driven mitochondrial ATP synthesis
GO:0051881	regulation of mitochondrial membrane potential
GO:0061458	reproductive system development
GO:0072359	circulatory system development
GO:0072497	mesenchymal stem cell differentiation
GO:0072593	reactive oxygen species metabolic process
GO:0090398	cellular senescence
GO:0097168	mesenchymal stem cell proliferation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0045271	respiratory chain complex I

External links

PDB	RCSB:7b93, PDBe:7b93, PDBj:7b93
PDBsum	7b93
PubMed	33990335
UniProt	P52503\|NDUS6_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial (Gene Name=Ndufs6)