Structure of PDB 7aue Chain R

Receptor sequence
>7aueR (length=263) Species: 9606 (Homo sapiens) [Search protein sequence]
CYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVA
DMLVSVSNGSETIVITLLNSFTVNIDNVIDSVICSSLLASICSLLSIAVD
RYFTIFYALQYHNIMTVKRVGIIISCIWAACTVSGILFIIYSDSSAVIIC
LITMFFTMLALMASLYVHMFLMARLHIKRIAVLPGNMKGAITLTILIGVF
VVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPLIYAL
RSQELRKTFKEII
3D structure
PDB7aue Structure reveals the activation mechanism of the MC4 receptor to initiate satiation signaling.
ChainR
Resolution2.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide R T101 I104 D122 I129 I185 S188 F284 T62 I65 D76 I83 I139 S142 F230
BS02 CA R E100 D122 D126 E61 D76 D80
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004977 melanocortin receptor activity
GO:0004980 melanocyte-stimulating hormone receptor activity
GO:0005515 protein binding
GO:0017046 peptide hormone binding
GO:0031625 ubiquitin protein ligase binding
GO:0042562 hormone binding
GO:0042923 neuropeptide binding
Biological Process
GO:0002024 diet induced thermogenesis
GO:0006112 energy reserve metabolic process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007631 feeding behavior
GO:0019222 regulation of metabolic process
GO:0030073 insulin secretion
GO:0032868 response to insulin
GO:0045780 positive regulation of bone resorption
GO:0060259 regulation of feeding behavior
GO:1903925 response to bisphenol A
GO:1903998 regulation of eating behavior
GO:1990680 response to melanocyte-stimulating hormone
GO:2000252 negative regulation of feeding behavior
GO:2000821 regulation of grooming behavior
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7aue, PDBe:7aue, PDBj:7aue
PDBsum7aue
PubMed33858992
UniProtP32245|MC4R_HUMAN Melanocortin receptor 4 (Gene Name=MC4R)

[Back to BioLiP]