Structure of PDB 7aqd Chain R

Receptor sequence

>7aqdR (length=433) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

SFDGMFTYGMTHELNEKIMGGRITKIHQPYKHDVIFHIRAKGKNQKLLLS
AHPSYSRVHITAQAYENPSEPPMFCMLLRKHIEGGFIEKIEQAGLDRIMI
FHIKSRNEIGDETVRKLYVEIMGRHSNIILTDAAENVIIDGLKHLSPSMN
SYRTVLPGQDYKLPPAQDKISPLEASEDDILRHLSFQEGRLDKQIVDHFS
GVSPLFAKEAVHRAGLANKVTLPKALLALFAEVKEHRFIPNITTVNGKEY
FYLLELTHLKGEARRFDSLSELLDRFYFGKAERDRVKQQAQDLERFVVNE
RKKNANKIKKLEKTLEYSENAKEFQLYGELLTANLYMLKKGDKQAEVINY
YDEESPTITIPLNPNKTPSENAQAYFTKYQKAKNSVAVVEEQIRLAQEEI
EYFDQLIQQLSSASPRDISEIREELVEGKYLRP

3D structure

• PDB: 7aqd Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
• Chain: R
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	M74 L146 S147 P158 K367 Q381 P434	M73 L145 S146 P157 K366 Q380 P433
BS02	rna	R	D4 H53 P54 S55 D97 R98 I122 M123 G124 R125 H126 S127 Q168 K194 V197 F200 S201 G202 V203 S204 P205 L206 F207 A208 K249 Y251 Y253 D285 K288 Q289 Q290 Q292 D293 E295 R296	D3 H52 P53 S54 D96 R97 I121 M122 G123 R124 H125 S126 Q167 K193 V196 F199 S200 G201 V202 S203 P204 L205 F206 A207 K248 Y250 Y252 D284 K287 Q288 Q289 Q291 D292 E294 R295

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0043023 ribosomal large subunit binding

Biological Process

• GO:0006412 translation
• GO:0072344 rescue of stalled ribosome

Cellular Component

• GO:1990112 RQC complex

External links

• PDB: RCSB:7aqd, PDBe:7aqd, PDBj:7aqd
• PDBsum: 7aqd
• PubMed: 33259811
• UniProt: O34693|RQCH_BACSU Rqc2 homolog RqcH (Gene Name=rqcH)