Structure of PDB 7a18 Chain R

Receptor sequence
>7a18R (length=110) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]
PSAGSHHNDKLHFKKGDTVIVLSGKHKGQTGKVLLALPRDQKVVVEGVNV
ITKNVKPSMTNPQGGQEQRELALHASKVALVDPETGKATRVRKQIVDGKK
VRVAVASGKT
3D structure
PDB7a18 Ribosome-binding and anti-microbial studies of the mycinamicins, 16-membered macrolide antibiotics from Micromonospora griseorubida.
ChainR
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R P4 H9 H10 N11 K13 H15 K17 K18 S26 G27 A39 P41 K45 I54 K56 N57 V58 K59 Q69 L74 H77 V94 P1 H6 H7 N8 K10 H12 K14 K15 S23 G24 A36 P38 K42 I51 K53 N54 V55 K56 Q66 L71 H74 V91
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a18, PDBe:7a18, PDBj:7a18
PDBsum7a18
PubMed34417608
UniProtQ9RXJ1|RL24_DEIRA Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]