Structure of PDB 6zm6 Chain R

Receptor sequence

>6zm6R (length=140) Species: 9606 (Homo sapiens) [Search protein sequence]

LRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYL
KKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYE
PKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH

3D structure

PDB

6zm6 Mechanism of membrane-tethered mitochondrial protein synthesis.

Chain

Resolution

2.59 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	L10 R11 N12 R13 V14 T15 R17 R20 H30 F31 R32 R34 K35 R37 Y39 R40 L41 V43 R44 R48 A49 K52 C53 A56 R57 Y58 K60 K61 M64 R65 W68 Y83 P84 N98 R99 K100 R124 F128	L1 R2 N3 R4 V5 T6 R8 R11 H21 F22 R23 R25 K26 R28 Y30 R31 L32 V34 R35 R39 A40 K43 C44 A47 R48 Y49 K51 K52 M55 R56 W59 Y74 P75 N89 R90 K91 R115 F119

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005761	mitochondrial ribosome
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6zm6, PDBe:6zm6, PDBj:6zm6
PDBsum	6zm6
PubMed	33602856
UniProt	Q9BYC9\|RM20_HUMAN Large ribosomal subunit protein bL20m (Gene Name=MRPL20)