Structure of PDB 6woo Chain R

Receptor sequence

>6wooR (length=188) Species: 4932 (Saccharomyces cerevisiae)

ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIV
KKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRV
LRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQR
EKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA

3D structure

• PDB: 6woo An active role of the eukaryotic large ribosomal subunit in translation initiation fidelity.
• Chain: R
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	A2 L4 R5 T6 K8 R9 L10 G18 K19 R20 K21 W23 L24 P26 S37 R38 N39 R42 K43 V55 T56 V57 H58 S59 K60 S61 R62 T63 R64 E72 R74 H75 G77 Y78 G79 K80 R81 K82 G83 T84 R85 A87 R88 L89 P90 Q92 V93 W95 I96 L99 R100 V101 R103 R104 R110 K114 H118 Y120 H121 Y124 K125 K128 G129 H134 K135 R136	A1 L3 R4 T5 K7 R8 L9 G17 K18 R19 K20 W22 L23 P25 S36 R37 N38 R41 K42 V54 T55 V56 H57 S58 K59 S60 R61 T62 R63 E71 R73 H74 G76 Y77 G78 K79 R80 K81 G82 T83 R84 A86 R87 L88 P89 Q91 V92 W94 I95 L98 R99 V100 R102 R103 R109 K113 H117 Y119 H120 Y123 K124 K127 G128 H133 K134 R135
BS02	rna	R	R162 R163 K165 N166 R173 R176 V177 R181	R161 R162 K164 N165 R172 R175 V176 R180

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6woo, PDBe:6woo, PDBj:6woo
• PDBsum: 6woo
• UniProt: P0CX82|RL19A_YEAST Large ribosomal subunit protein eL19A (Gene Name=RPL19A)