Structure of PDB 6wd2 Chain R

Receptor sequence

>6wd2R (length=114) Species: 562 (Escherichia coli) [Search protein sequence]

ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKP

3D structure

PDB

6wd2 Cryo-EM of elongating ribosome with EF-Tu•GTP elucidates tRNA proofreading.

Chain

Resolution

3.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	K12 H13 I16 Y22 G23 V24 G25 T27 R28 I76 Y85 R86 R89 H90 L94 P95 V96 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 K109 R112 P114	K12 H13 I16 Y22 G23 V24 G25 T27 R28 I76 Y85 R86 R89 H90 L94 P95 V96 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 K109 R112 P114
BS02	rna	R	M80 R91	M80 R91

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6wd2, PDBe:6wd2, PDBj:6wd2
PDBsum	6wd2
PubMed	32612237
UniProt	P0A7S9\|RS13_ECOLI Small ribosomal subunit protein uS13 (Gene Name=rpsM)