Structure of PDB 6t83 Chain R

Receptor sequence

>6t83R (length=112) Species: 4932 (Saccharomyces cerevisiae)

AQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSAL
QGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIV
KKVVKEQTEAAK

3D structure

• PDB: 6t83 Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
• Chain: R
• Resolution: 4.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	R	R4 V5 T6 F7 R8 R9 R10 N11 P12 Y13 N14 T15 K24 P26 G27 R31 Q33 K36 K37 L38 T40 R41 Q52 G53 S55 R58 P59 R60 A63 T64 S66 K67 T68 K70 V72 S73 R74 R80 R88 R91 I95 Q98 K99 K113	R3 V4 T5 F6 R7 R8 R9 N10 P11 Y12 N13 T14 K23 P25 G26 R30 Q32 K35 K36 L37 T39 R40 Q51 G52 S54 R57 P58 R59 A62 T63 S65 K66 T67 K69 V71 S72 R73 R79 R87 R90 I94 Q97 K98 K112

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6t83, PDBe:6t83, PDBj:6t83
• PDBsum: 6t83
• PubMed: 31858614
• UniProt: P87262|RL34A_YEAST Large ribosomal subunit protein eL34A (Gene Name=RPL34A)