Structure of PDB 6s12 Chain R

Receptor sequence
>6s12R (length=89) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
EARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVA
SVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLF
3D structure
PDB6s12 Exit tunnel modulation as resistance mechanism of S. aureus erythromycin resistant mutant.
ChainR
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R T13 E14 K15 K24 R32 K35 M40 N54 I55 M56 Y58 K59 K61 K63 M65 Y68 Q69 N73 R76 K77 T12 E13 K14 K23 R31 K34 M39 N53 I54 M55 Y57 K58 K60 K62 M64 Y67 Q68 N72 R75 K76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s12, PDBe:6s12, PDBj:6s12
PDBsum6s12
PubMed31391518
UniProtW8TUB4

[Back to BioLiP]