Structure of PDB 6quq Chain R

Receptor sequence
>6quqR (length=334) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSV
HGQWKHNELKIKDEKTLLFGEKPVTVFGIRNPEDIPWAEAGADYVVESTG
VFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNA
SCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGR
AASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLE
KAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAG
IALSDKFVKLVSWYDNEWGYSSRVVDLIVHMSKA
3D structure
PDB6quq Glutathionylation primes soluble glyceraldehyde-3-phosphate dehydrogenase for late collapse into insoluble aggregates.
ChainR
Resolution2.993 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C149 H176
Catalytic site (residue number reindexed from 1) C152 H179
Enzyme Commision number 1.2.1.12: glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAD R G7 F8 G9 R10 I11 D32 P33 F34 T96 G97 S119 A180 N313 Y317 G8 F9 G10 R11 I12 D33 P34 F35 T99 G100 S122 A183 N316 Y320
BS02 GSH R P121 S148 C149 H176 S206 T208 S229 R231 P124 S151 C152 H179 S209 T211 S232 R234
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0005507 copper ion binding
GO:0005515 protein binding
GO:0008886 glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding
GO:1901149 salicylic acid binding
Biological Process
GO:0006006 glucose metabolic process
GO:0006094 gluconeogenesis
GO:0006096 glycolytic process
GO:0006979 response to oxidative stress
GO:0009408 response to heat
GO:0009744 response to sucrose
GO:0010154 fruit development
GO:0042542 response to hydrogen peroxide
GO:0045893 positive regulation of DNA-templated transcription
GO:0048316 seed development
GO:0051775 response to redox state
Cellular Component
GO:0000325 plant-type vacuole
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005740 mitochondrial envelope
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009507 chloroplast
GO:0048046 apoplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6quq, PDBe:6quq, PDBj:6quq
PDBsum6quq
PubMed31772010
UniProtP25858|G3PC1_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic (Gene Name=GAPC1)

[Back to BioLiP]