Structure of PDB 6pt0 Chain R

Receptor sequence
>6pt0R (length=298) Species: 9606 (Homo sapiens) [Search protein sequence]
MKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYL
FIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASV
GSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMG
WTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVA
SLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLAT
TLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKK
3D structure
PDB6pt0 Cryo-EM Structure of the Human Cannabinoid Receptor CB2-GiSignaling Complex.
ChainR
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 WI5 R F87 S90 F94 I110 T114 F183 P184 Y190 L191 W194 F66 S69 F73 I89 T93 F162 P163 Y169 L170 W173 BindingDB: Ki=2.1nM,EC50=24.6nM,IC50=3.4nM
BS02 CLR R Q276 F283 Q255 F262
BS03 CLR R I129 L133 L144 I108 L112 L123
BS04 CLR R G210 L213 W214 G189 L192 W193
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004949 cannabinoid receptor activity
GO:0005515 protein binding
Biological Process
GO:0001975 response to amphetamine
GO:0006954 inflammatory response
GO:0006955 immune response
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0019222 regulation of metabolic process
GO:0030595 leukocyte chemotaxis
GO:0032229 negative regulation of synaptic transmission, GABAergic
GO:0032496 response to lipopolysaccharide
GO:0033004 negative regulation of mast cell activation
GO:0038171 cannabinoid signaling pathway
GO:0045759 negative regulation of action potential
GO:0099553 trans-synaptic signaling by endocannabinoid, modulating synaptic transmission
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030425 dendrite
GO:0031234 extrinsic component of cytoplasmic side of plasma membrane
GO:0042995 cell projection
GO:0043025 neuronal cell body
GO:0043204 perikaryon
GO:0045211 postsynaptic membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6pt0, PDBe:6pt0, PDBj:6pt0
PDBsum6pt0
PubMed32004460
UniProtP34972|CNR2_HUMAN Cannabinoid receptor 2 (Gene Name=CNR2)

[Back to BioLiP]