Structure of PDB 6ppk Chain R

Receptor sequence
>6ppkR (length=100) Species: 1423 (Bacillus subtilis) [Search protein sequence]
YAIIKTGGKQIKVEEGQTVYIEKLAAEAGETVTFEDVLFVGGDNVKVGNP
TVEGATVTAKVEKQGRAKKITVFRYKPKKNVHKKQGHRQPYTKVTIEKIN
3D structure
PDB6ppk Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
ChainR
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R G8 G9 K10 Y21 E23 K24 K64 R67 K69 K70 V73 R75 Y76 K77 P78 K79 K80 N81 H83 K84 K85 Q86 G87 H88 Q90 Y92 G7 G8 K9 Y20 E22 K23 K63 R66 K68 K69 V72 R74 Y75 K76 P77 K78 K79 N80 H82 K83 K84 Q85 G86 H87 Q89 Y91
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppk, PDBe:6ppk, PDBj:6ppk
PDBsum6ppk
PubMed31665744
UniProtP26908|RL21_BACSU Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]