Structure of PDB 6ppf Chain R

Receptor sequence
>6ppfR (length=96) Species: 1423 (Bacillus subtilis) [Search protein sequence]
YAIIKTGGKQIKVEEGQTVYIEKLETVTFEDVLFVGGDNVKVGNPTVEGA
TVTAKVEKQGRAKKITVFRYKPKKNVHKKQGHRQPYTKVTIEKINA
3D structure
PDB6ppf Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
ChainR
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna R K10 Y21 K24 R67 K70 R75 Y76 K80 N81 K84 K85 Q86 G87 H88 R89 K9 Y20 K23 R61 K64 R69 Y70 K74 N75 K78 K79 Q80 G81 H82 R83
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppf, PDBe:6ppf, PDBj:6ppf
PDBsum6ppf
PubMed31665744
UniProtP26908|RL21_BACSU Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]