Structure of PDB 6pgk Chain R

Receptor sequence
>6pgkR (length=38) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
MMGSYAASFLPWIFIPVVCWLMPTVVMGLLFLYIEGEA
3D structure
PDB6pgk Membrane protein megahertz crystallography at the European XFEL.
ChainR
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA R L10 P11 F14 V18 L10 P11 F14 V18
BS02 CLA R P23 V26 P23 V26
BS03 CLA R C19 W20 C19 W20
BS04 CLA R W20 F31 W20 F31
BS05 CLA R T24 M27 T24 M27
BS06 CLA R W20 L21 W20 L21
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6pgk, PDBe:6pgk, PDBj:6pgk
PDBsum6pgk
PubMed31685819
UniProtP0A427|PSAI_THEVB Photosystem I reaction center subunit VIII (Gene Name=psaI)

[Back to BioLiP]